AS Number
AS20649
AS Name
ASFIBERSUNUCU
Org Name
FS Veri Merkezi Internet Teknolojileri Limited Sirketi
Country
Turkey
Registry

ripe

RegDate

N/A

Updated

2021-10-13T08:39:00Z

AS20649 Looking Glass
IPv4Prefixes

17

IPv6Prefixes

0

IPv4 NUMs

4,352

IPv6 NUMs(/64)

0

4,352 IPv4 Addresses
CIDR Description IP Num
78.111.97.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
78.111.98.0/24
ROA Signed and Valid IRR Valid
Seohosting 256
78.111.106.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
80.93.208.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
80.93.212.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
80.93.213.0/24
ROA Signed and Valid IRR Valid
Seohosting 256
80.93.214.0/24
IRR InValid
G-Core Labs S.A. 256
80.93.216.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
188.132.169.0/24
ROA Signed and Valid IRR Valid
PremierDC Veri Merkezi Anonim Sirketi 256
188.132.179.0/24
ROA Signed and Valid IRR Valid
PremierDC Veri Merkezi Anonim Sirketi 256
217.195.192.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
217.195.196.0/24
ROA Signed and Valid IRR Valid
WEBIM 256
217.195.198.0/24
ROA Signed and Valid IRR Valid
Daynex 256
217.195.200.0/24
IRR InValid
G-Core Labs S.A. 256
217.195.203.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
217.195.204.0/24
ROA Signed and Valid IRR Valid
FS Veri Merkezi Internet Teknolojileri Limited Sirketi 256
217.195.206.0/24
ROA Signed and Valid IRR Valid
Performans 256
AS Description Country/Region IPv4 NUMs IPv6 NUMs IPv4 IPv6
AS42910 PREMIERDC-VERI-MERKEZI-ANONIM-SIRKETI - PremierDC Veri Merkezi Anonim Sirketi, TR Turkey 46,592 68,719,542,272 IPv4 IPv4
AS Description Country/Region IPv4 NUMs IPv6 NUMs IPv4 IPv6
AS210666 BIRNETTELEKOM - 1 NET TELEKOM VE ILETISIM HIZMETLERI PAZARLAMA SANAYI TICARET LIMITED SIRKETI, TR Turkey 1,024 0 IPv4 IPv4

Peers at this Exchange Point

Country/Region IX IPv4 IPv6 Port Speed Updated
Turkey ISTIX - ISTANBUL INTERNET EXCHANGE/DE-CIX Istanbul 185.1.202.18 10 Gbps 2021-05-07 14:23:57

Private Peering Facilities

Country/Region Name City Website Updated
COMNET Datacenter Istanbul Istanbul http://www.comnet.com.tr 2021-05-07 14:24:02
PremierDC Veri Merkezi A.S. - Istanbul ─░stanbul https://www.premierdc.com.tr 2021-05-07 14:24:10
IP Address Domain NUMs Domains
78.111.97.3 1 nadiryazilimci.site
78.111.97.5 1 mail.galmanak.com
78.111.97.10 6 bayrampasakarelsantralservisi.com
78.111.97.26 5 camliyanginkapisi.com
78.111.97.28 287 7020.com.tr
as-block:       AS20485 - AS20857
descr:          RIPE NCC ASN block
remarks:        These AS Numbers are assigned to network operators in the RIPE NCC service region.
mnt-by:         RIPE-NCC-HM-MNT
created:        2018-11-22T15:27:27Z
last-modified:  2018-11-22T15:27:27Z
source:         RIPE



aut-num:        AS20649
as-name:        ASFIBERSUNUCU
org:            ORG-TIEH1-RIPE
admin-c:        FBSN34
tech-c:         FBSN35
import:         from AS201364 accept ANY
import:         from AS210666 accept ANY
import:         from AS42910 accept ANY
export:         to AS201364 announce AS20649
export:         to AS210666 announce AS20649
export:         to AS42910 announce AS20649
mp-import:      afi ipv6.unicast from as42910 accept ANY
mp-export:      afi ipv6.unicast to as42910 announce as20649
status:         ASSIGNED
mnt-by:         RIPE-NCC-END-MNT
mnt-by:         MNT-FIBERSUNUCU
created:        1970-01-01T00:00:00Z
last-modified:  2021-10-13T08:39:00Z
source:         RIPE

organisation:   ORG-TIEH1-RIPE
org-name:       FS Veri Merkezi Internet Teknolojileri Limited Sirketi
country:        TR
org-type:       LIR
address:        Rami Kisla Cad. Turkuaz Atlas Is Merkezi No 57 Kat 2
address:        34055
address:        Istanbul
address:        TURKEY
phone:          +902129001222
fax-no:         +902128762044
e-mail:         ipadm@fibersunucu.com.tr
abuse-c:        AR17346-RIPE
mnt-ref:        RIPE-NCC-HM-MNT
mnt-ref:        MNT-FIBERSUNUCU
mnt-ref:        AS42910
mnt-by:         RIPE-NCC-HM-MNT
mnt-by:         MNT-FIBERSUNUCU
created:        2004-04-17T12:08:11Z
last-modified:  2020-12-16T12:28:50Z
source:         RIPE
admin-c:        FBSN34

person:         Fibersunucu IP Administrator
address:        Rami Kisla Cad. Turkuaz Atlas Is Merkezi No: 57 Kat 2 PK 34055
address:        Eyup/Istanbul/Turkey
phone:          +90 212 900 12 22
fax-no:         +90 212 876 20 44
nic-hdl:        FBSN34
mnt-by:         MNT-FIBERSUNUCU
mnt-by:         TEKNOTEL-MNT
created:        2014-11-19T15:34:13Z
last-modified:  2017-10-30T22:40:49Z
source:         RIPE

person:         Fibersunucu NOC
address:        Rami Kisla Cad. Turkuaz Atlas Is Merkezi No: 57 Kat 2 PK 34055
address:        Eyup/Istanbul/Turkey
phone:          +90 212 900 12 22
fax-no:         +90 212 876 20 44
nic-hdl:        FBSN35
mnt-by:         MNT-FIBERSUNUCU
created:        2014-11-19T16:15:12Z
last-modified:  2017-10-30T22:40:50Z
source:         RIPE